PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 262aa    MW: 30165.5 Da    PI: 9.1224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597083.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-131663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l   +  +G  +W+t++ + g+ R +k+c++rw +yl
   XP_013597083.1 16 KGFWSPDEDEKLRSFILSHGHSCWTTVPIKAGLQRNGKSCRLRWINYL 63
                     688*******************************************97 PP

2Myb_DNA-binding44.92.6e-1473114548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +eE+e+++  +  lG++ W++Ia+ ++ gRt++++k++w+++l
   XP_013597083.1  73 NAEEEEIILTFHSSLGNK-WSRIAKFLP-GRTDNEIKNYWHSHL 114
                      68****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3521163IPR017930Myb domain
SuperFamilySSF466892.43E-2613110IPR009057Homeodomain-like
SMARTSM007175.1E-91565IPR001005SANT/Myb domain
PfamPF002494.4E-111763IPR001005SANT/Myb domain
CDDcd001672.58E-71963No hitNo description
Gene3DG3DSA:1.10.10.602.3E-191970IPR009057Homeodomain-like
PROSITE profilePS5129422.164118IPR017930Myb domain
SMARTSM007178.2E-1468116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2371118IPR009057Homeodomain-like
CDDcd001678.50E-1073114No hitNo description
PfamPF002492.4E-1274114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MVKTIAGERP KQRQRKGFWS PDEDEKLRSF ILSHGHSCWT TVPIKAGLQR NGKSCRLRWI  60
NYLRPGLKRD VINAEEEEII LTFHSSLGNK WSRIAKFLPG RTDNEIKNYW HSHLKKKWLK  120
SQKLQHARSI STSSESLVAC GRRNPQTLIS NHVISFQPLQ EKTSSSPSQE SNDNNNNNNN  180
SYSCSSGPEI PRLFFSEWFT SSDPYFDHSS NLTDSNHIQT PNIQGTVSDY EESGDVNQFY  240
YNEMVMMSNS NWTLNDVVFG SK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23161177107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196091e-141AY519609.1 Arabidopsis thaliana MYB transcription factor (At4g25560) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597083.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K41e-140LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0D3DG410.0A0A0D3DG41_BRAOL; Uncharacterized protein
STRINGBra019154.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-114myb domain protein 18